SCOP 1.69: Domain d1nwyp_: 1nwy P:

Lineage for d1nwyp_ (1nwy P:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)

8. Domain d1nwyp_: 1nwy P: [86360]

Details for d1nwyp_

PDB Entry: 1nwy, 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

SCOP Domain Sequences for d1nwyp_:

Sequence; same for both SEQRES and ATOM records:

>d1nwyp_ i.1.1.2 (P:) 50S subunit {Deinococcus radiodurans}
mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg

Timeline for d1nwyp_:

• d1nwyp_ first appeared in SCOP 1.65
  
• d1nwyp_ appears in SCOP 1.67
  
• d1nwyp_ appears in SCOP 1.71
  
• d1nwyp_ appears in the current release, SCOPe 2.08