| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein 50S subunit [58125] (3 species) |
| Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries) |
| Domain d1nwyh_: 1nwy H: [86352] |
PDB Entry: 1nwy (more details), 3.3 Å
SCOP Domain Sequences for d1nwyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwyh_ i.1.1.2 (H:) 50S subunit {Deinococcus radiodurans}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl
Timeline for d1nwyh_:
View in 3DDomains from other chains: (mouse over for more information) d1nwy0_, d1nwy1_, d1nwy2_, d1nwy3_, d1nwy4_, d1nwy9_, d1nwya_, d1nwyb_, d1nwyc_, d1nwyd_, d1nwye_, d1nwyf_, d1nwyg_, d1nwyi_, d1nwyj_, d1nwyk_, d1nwyl_, d1nwym_, d1nwyn_, d1nwyo_, d1nwyp_, d1nwyq_, d1nwyr_, d1nwys_, d1nwyt_, d1nwyu_, d1nwyw_, d1nwyx_, d1nwyy_, d1nwyz_ |