Lineage for d1nwy3_ (1nwy 3:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627824Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 627828Protein 50S subunit [58125] (3 species)
  7. 627866Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)
  8. 627926Domain d1nwy3_: 1nwy 3: [86342]

Details for d1nwy3_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

SCOP Domain Sequences for d1nwy3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwy3_ i.1.1.2 (3:) 50S subunit {Deinococcus radiodurans}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOP Domain Coordinates for d1nwy3_:

Click to download the PDB-style file with coordinates for d1nwy3_.
(The format of our PDB-style files is described here.)

Timeline for d1nwy3_: