SCOPe 2.04: Domain d1nwva1: 1nwv A:61-127

Lineage for d1nwva1 (1nwv A:61-127)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries)

8. Domain d1nwva1: 1nwv A:61-127 [86304]
   modules 2 and 3; a functionally active component of Daf

Details for d1nwva1

PDB Entry: 1nwv

PDB Description: solution structure of a functionally active component of decay accelerating factor

PDB Compounds: (A:) complement decay-accelerating factor

SCOPe Domain Sequences for d1nwva1:

Sequence; same for both SEQRES and ATOM records:

>d1nwva1 g.18.1.1 (A:61-127) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
frscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta
vefckkk

Timeline for d1nwva1:

• d1nwva1 first appeared in SCOP 1.65
  
• d1nwva1 appears in SCOPe 2.03
  
• d1nwva1 appears in SCOPe 2.05
  
• d1nwva1 appears in the current release, SCOPe 2.08