PDB entry 1nwv

View 1nwv on RCSB PDB site
Description: solution structure of a functionally active component of decay accelerating factor
Class: biosynthetic protein
Keywords: CD55, DAF, CCP, complement, BIOSYNTHETIC PROTEIN
Deposited on 2003-02-07, released 2003-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement decay-accelerating factor
  Species: Homo sapiens [TaxId:9606]
  Gene: DAF OR CR OR CD55
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08174 (1-127)
    • cloning artifact (0)
    • cloning artifact (128)
  Domains in SCOPe 2.04: d1nwva1, d1nwva2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nwvA (A:)
  frscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta
  vefckkkscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqws
  dplpecreh