Lineage for d1nsle1 (1nsl E:1-179)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575239Protein Probable acetyltransferase YdaF [90015] (1 species)
  7. 2575240Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)
  8. 2575245Domain d1nsle1: 1nsl E:1-179 [86141]
    Other proteins in same PDB: d1nsla2, d1nslb2, d1nslc2, d1nsld2, d1nsle2, d1nslf2
    structural genomics
    complexed with cl

Details for d1nsle1

PDB Entry: 1nsl (more details), 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase
PDB Compounds: (E:) Probable acetyltransferase

SCOPe Domain Sequences for d1nsle1:

Sequence, based on SEQRES records: (download)

>d1nsle1 d.108.1.1 (E:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwrr
qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records): (download)

>d1nsle1 d.108.1.1 (E:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffenpssadtyretiipdwrrq
yadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklitya
feelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

SCOPe Domain Coordinates for d1nsle1:

Click to download the PDB-style file with coordinates for d1nsle1.
(The format of our PDB-style files is described here.)

Timeline for d1nsle1: