Lineage for d1nslc_ (1nsl C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1214852Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1215088Protein Probable acetyltransferase YdaF [90015] (1 species)
  7. 1215089Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)
  8. 1215092Domain d1nslc_: 1nsl C: [86139]
    structural genomics
    complexed with cl

Details for d1nslc_

PDB Entry: 1nsl (more details), 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase
PDB Compounds: (C:) Probable acetyltransferase

SCOPe Domain Sequences for d1nslc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nslc_ d.108.1.1 (C:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

SCOPe Domain Coordinates for d1nslc_:

Click to download the PDB-style file with coordinates for d1nslc_.
(The format of our PDB-style files is described here.)

Timeline for d1nslc_: