| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
| Protein Probable acetyltransferase YdaF [90015] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry) |
| Domain d1nslc1: 1nsl C:1-179 [86139] Other proteins in same PDB: d1nsla2, d1nslb2, d1nslc2, d1nsld2, d1nsle2, d1nslf2 structural genomics complexed with cl |
PDB Entry: 1nsl (more details), 2.7 Å
SCOPe Domain Sequences for d1nslc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nslc1 d.108.1.1 (C:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwrr
qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
Timeline for d1nslc1: