SCOPe 2.01: Domain d1no1a_: 1no1 A:

Lineage for d1no1a_ (1no1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.179: Replisome organizer (g39p helicase loader/inhibitor protein) [89063] (1 superfamily)
   4 helices; bundle, right-handed twist; left-handed superhelix

4. Superfamily a.179.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89064] (1 family)

5. Family a.179.1.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89065] (1 protein)

6. Protein Replisome organizer (g39p helicase loader/inhibitor protein) [89066] (1 species)

7. Species Bacteriophage Spp1 [TaxId:10724] [89067] (1 PDB entry)

8. Domain d1no1a_: 1no1 A: [85913]
   truncated variant

Details for d1no1a_

PDB Entry: 1no1, 2.4 Å

PDB Description: Structure of truncated variant of B.subtilis SPP1 phage G39P helicase loader/inhibitor protein

PDB Compounds: (A:) replisome organizer

SCOPe Domain Sequences for d1no1a_:

Sequence; same for both SEQRES and ATOM records:

>d1no1a_ a.179.1.1 (A:) Replisome organizer (g39p helicase loader/inhibitor protein) {Bacteriophage Spp1 [TaxId: 10724]}
miekdvvqilkavsefypgrfqpddlkgtvkawhrvlaeyeleeimnnltdyakvnkfpp
tvsdllk

Timeline for d1no1a_:

• d1no1a_ first appeared in SCOP 1.65
  
• d1no1a_ appears in SCOP 1.75
  
• d1no1a_ appears in SCOPe 2.02
  
• d1no1a_ appears in the current release, SCOPe 2.08, called d1no1a1