Lineage for d1no1a_ (1no1 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927359Fold a.179: Replisome organizer (g39p helicase loader/inhibitor protein) [89063] (1 superfamily)
    4 helices; bundle, right-handed twist; left-handed superhelix
  4. 927360Superfamily a.179.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89064] (1 family) (S)
  5. 927361Family a.179.1.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89065] (1 protein)
  6. 927362Protein Replisome organizer (g39p helicase loader/inhibitor protein) [89066] (1 species)
  7. 927363Species Bacteriophage Spp1 [TaxId:10724] [89067] (1 PDB entry)
  8. 927364Domain d1no1a_: 1no1 A: [85913]
    truncated variant

Details for d1no1a_

PDB Entry: 1no1 (more details), 2.4 Å

PDB Description: Structure of truncated variant of B.subtilis SPP1 phage G39P helicase loader/inhibitor protein
PDB Compounds: (A:) replisome organizer

SCOPe Domain Sequences for d1no1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1no1a_ a.179.1.1 (A:) Replisome organizer (g39p helicase loader/inhibitor protein) {Bacteriophage Spp1 [TaxId: 10724]}
miekdvvqilkavsefypgrfqpddlkgtvkawhrvlaeyeleeimnnltdyakvnkfpp
tvsdllk

SCOPe Domain Coordinates for d1no1a_:

Click to download the PDB-style file with coordinates for d1no1a_.
(The format of our PDB-style files is described here.)

Timeline for d1no1a_: