Lineage for d1no1a1 (1no1 A:2-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736044Fold a.179: Replisome organizer (g39p helicase loader/inhibitor protein) [89063] (1 superfamily)
    4 helices; bundle, right-handed twist; left-handed superhelix
  4. 2736045Superfamily a.179.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89064] (1 family) (S)
  5. 2736046Family a.179.1.1: Replisome organizer (g39p helicase loader/inhibitor protein) [89065] (1 protein)
  6. 2736047Protein Replisome organizer (g39p helicase loader/inhibitor protein) [89066] (1 species)
  7. 2736048Species Bacteriophage Spp1 [TaxId:10724] [89067] (1 PDB entry)
  8. 2736049Domain d1no1a1: 1no1 A:2-67 [85913]
    Other proteins in same PDB: d1no1a2, d1no1b2, d1no1c2
    truncated variant

Details for d1no1a1

PDB Entry: 1no1 (more details), 2.4 Å

PDB Description: Structure of truncated variant of B.subtilis SPP1 phage G39P helicase loader/inhibitor protein
PDB Compounds: (A:) replisome organizer

SCOPe Domain Sequences for d1no1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1no1a1 a.179.1.1 (A:2-67) Replisome organizer (g39p helicase loader/inhibitor protein) {Bacteriophage Spp1 [TaxId: 10724]}
iekdvvqilkavsefypgrfqpddlkgtvkawhrvlaeyeleeimnnltdyakvnkfppt
vsdllk

SCOPe Domain Coordinates for d1no1a1:

Click to download the PDB-style file with coordinates for d1no1a1.
(The format of our PDB-style files is described here.)

Timeline for d1no1a1: