SCOP 1.69: Domain d1nnpb_: 1nnp B:

Lineage for d1nnpb_ (1nnp B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (2 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (43 PDB entries)

8. Domain d1nnpb_: 1nnp B: [85909]

Details for d1nnpb_

PDB Entry: 1nnp, 1.9 Å

PDB Description: x-ray structure of the glur2 ligand-binding core (s1s2j) in complex with (s)-atpa at 1.9 a resolution. crystallization without zinc ions.

SCOP Domain Sequences for d1nnpb_:

Sequence; same for both SEQRES and ATOM records:

>d1nnpb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1nnpb_:

• d1nnpb_ first appeared in SCOP 1.65
  
• d1nnpb_ appears in SCOP 1.67
  
• d1nnpb_ appears in SCOP 1.71
  
• d1nnpb_ appears in the current release, SCOPe 2.08