Lineage for d1nnpb_ (1nnp B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2486152Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2486164Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (137 PDB entries)
  8. 2486204Domain d1nnpb_: 1nnp B: [85909]
    complexed with ce2, so4

Details for d1nnpb_

PDB Entry: 1nnp (more details), 1.9 Å

PDB Description: x-ray structure of the glur2 ligand-binding core (s1s2j) in complex with (s)-atpa at 1.9 a resolution. crystallization without zinc ions.
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d1nnpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnpb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d1nnpb_:

Click to download the PDB-style file with coordinates for d1nnpb_.
(The format of our PDB-style files is described here.)

Timeline for d1nnpb_: