| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (16 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
| Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries) |
| Domain d1nneb2: 1nne B:1542-1765 [85900] Other proteins in same PDB: d1nnea1, d1nnea3, d1nnea4, d1nneb1, d1nneb3, d1nneb4 complexed with adp, bef, edo, so4 |
PDB Entry: 1nne (more details), 3.11 Å
SCOP Domain Sequences for d1nneb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nneb2 c.37.1.12 (B:1542-1765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
Timeline for d1nneb2:
View in 3DDomains from other chains: (mouse over for more information) d1nnea1, d1nnea2, d1nnea3, d1nnea4 |