SCOPe 2.08: Domain d1nneb2: 1nne B:1542-1765

Lineage for d1nneb2 (1nne B:1542-1765)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)

8. Domain d1nneb2: 1nne B:1542-1765 [85900]
   Other proteins in same PDB: d1nnea1, d1nnea3, d1nnea4, d1nneb1, d1nneb3, d1nneb4
   protein/DNA complex; complexed with adp, bef, edo, so4

Details for d1nneb2

PDB Entry: 1nne, 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1nneb2:

Sequence; same for both SEQRES and ATOM records:

>d1nneb2 c.37.1.12 (B:1542-1765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

Timeline for d1nneb2:

• d1nneb2 first appeared in SCOP 1.65
  
• d1nneb2 appears in SCOPe 2.07