Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries) |
Domain d1nneb2: 1nne B:1542-1765 [85900] Other proteins in same PDB: d1nnea1, d1nnea3, d1nnea4, d1nneb1, d1nneb3, d1nneb4 protein/DNA complex; complexed with adp, bef, edo, so4 |
PDB Entry: 1nne (more details), 3.11 Å
SCOPe Domain Sequences for d1nneb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nneb2 c.37.1.12 (B:1542-1765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
Timeline for d1nneb2:
View in 3D Domains from other chains: (mouse over for more information) d1nnea1, d1nnea2, d1nnea3, d1nnea4 |