PDB entry 1nne

View 1nne on RCSB PDB site
Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
Deposited on 2003-01-13, released 2003-05-20
The last revision prior to the SCOP 1.67 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nneA (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nneA (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgr
    gtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyh
    qvlpgpasksygvevaamaglpkevvararallqamaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nneB (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nneB (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqveplvrrevtqlltpgtllqesl
    lpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapelle
    ngafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqpfrfydp
    gafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrgplearl
    drvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilpelrall
    geevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregvayflele
    ererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpemkeker
    evyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavrygyvrpr
    fgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtaliallaqvg
    sfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvlldevgr
    gtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyh
    qvlpgpasksygvevaamaglpkevvararallqamaar