Lineage for d1nm8a2 (1nm8 A:386-599)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599449Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1599450Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1599543Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 1599544Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 1599545Species Human (Homo sapiens) [TaxId:9606] [89697] (2 PDB entries)
  8. 1599547Domain d1nm8a2: 1nm8 A:386-599 [85873]

Details for d1nm8a2

PDB Entry: 1nm8 (more details), 1.6 Å

PDB Description: Structure of Human Carnitine Acetyltransferase: Molecular Basis for Fatty Acyl Transfer
PDB Compounds: (A:) Carnitine O-acetyltransferase

SCOPe Domain Sequences for d1nm8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm8a2 c.43.1.3 (A:386-599) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
lditvmvfhhfgkdfpkseklspdafiqmalqlayyriygqacatyesaslrmfhlgrtd
tirsasmdsltfvkamddssvtehqkvellrkavqahrgytdrairgeafdrhllglklq
aiedlvstpdifmdtsyaiamhfhlstsqvpaktdcvmffgpvvpdgygvcynpmeahin
fslsaynscaetnaarlahylekalldmrallqs

SCOPe Domain Coordinates for d1nm8a2:

Click to download the PDB-style file with coordinates for d1nm8a2.
(The format of our PDB-style files is described here.)

Timeline for d1nm8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nm8a1