Lineage for d1nm8a2 (1nm8 A:386-599)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315032Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 315033Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 315077Family c.43.1.3: Carnitine acetyltransferase [82424] (1 protein)
    monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 315078Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 315079Species Human (Homo sapiens) [TaxId:9606] [89697] (1 PDB entry)
  8. 315081Domain d1nm8a2: 1nm8 A:386-599 [85873]

Details for d1nm8a2

PDB Entry: 1nm8 (more details), 1.6 Å

PDB Description: Structure of Human Carnitine Acetyltransferase: Molecular Basis for Fatty Acyl Transfer

SCOP Domain Sequences for d1nm8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm8a2 c.43.1.3 (A:386-599) Carnitine acetyltransferase {Human (Homo sapiens)}
lditvmvfhhfgkdfpkseklspdafiqmalqlayyriygqacatyesaslrmfhlgrtd
tirsasmdsltfvkamddssvtehqkvellrkavqahrgytdrairgeafdrhllglklq
aiedlvstpdifmdtsyaiamhfhlstsqvpaktdcvmffgpvvpdgygvcynpmeahin
fslsaynscaetnaarlahylekalldmrallqs

SCOP Domain Coordinates for d1nm8a2:

Click to download the PDB-style file with coordinates for d1nm8a2.
(The format of our PDB-style files is described here.)

Timeline for d1nm8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nm8a1