Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species) a pre-protein crosslinking domain inserted in the first AAA domain |
Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries) |
Domain d1nl3b4: 1nl3 B:397-615 [85846] Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3b1, d1nl3b2 |
PDB Entry: 1nl3 (more details), 2.8 Å
SCOPe Domain Sequences for d1nl3b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl3b4 c.37.1.19 (B:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd pgesrfylslgdelmrrfngaaletlltrlnlpddvpie
Timeline for d1nl3b4:
View in 3D Domains from other chains: (mouse over for more information) d1nl3a1, d1nl3a2, d1nl3a3, d1nl3a4 |