Lineage for d1nl3b1 (1nl3 B:226-349)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927115Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
    core: 4 helices: bundle; flanked by two short beta-hairpins
    duplication: consists of two structural repeats
  4. 927116Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) (S)
  5. 927117Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)
  6. 927118Protein Pre-protein crosslinking domain of SecA [81769] (2 species)
  7. 927124Species Mycobacterium tuberculosis [TaxId:1773] [89058] (2 PDB entries)
  8. 927128Domain d1nl3b1: 1nl3 B:226-349 [85843]
    Other proteins in same PDB: d1nl3a2, d1nl3a3, d1nl3a4, d1nl3b2, d1nl3b3, d1nl3b4

Details for d1nl3b1

PDB Entry: 1nl3 (more details), 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form
PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nl3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl3b1 a.162.1.1 (B:226-349) Pre-protein crosslinking domain of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
gpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaans
plvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehve
ikae

SCOPe Domain Coordinates for d1nl3b1:

Click to download the PDB-style file with coordinates for d1nl3b1.
(The format of our PDB-style files is described here.)

Timeline for d1nl3b1: