Lineage for d1nj8b1 (1nj8 B:268-393)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2135876Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2135877Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2135923Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 2135924Species Methanocaldococcus jannaschii [TaxId:2190] [89715] (1 PDB entry)
  8. 2135926Domain d1nj8b1: 1nj8 B:268-393 [85772]
    Other proteins in same PDB: d1nj8a2, d1nj8a3, d1nj8a4, d1nj8b2, d1nj8b3, d1nj8b4, d1nj8c2, d1nj8c3, d1nj8c4, d1nj8d2, d1nj8d3, d1nj8d4

Details for d1nj8b1

PDB Entry: 1nj8 (more details), 3.2 Å

PDB Description: Crystal Structure of Prolyl-tRNA Synthetase from Methanocaldococcus janaschii
PDB Compounds: (B:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj8b1 c.51.1.1 (B:268-393) Prolyl-tRNA synthetase (ProRS) domain {Methanocaldococcus jannaschii [TaxId: 2190]}
kglilppivapiqvvivplifkgkedivmekakeiyeklkgkfrvhiddrdirpgrkfnd
weikgvplrievgpkdienkkitlfrrdtmekfqvdetqlmevvektlnnimeniknraw
ekfenf

SCOPe Domain Coordinates for d1nj8b1:

Click to download the PDB-style file with coordinates for d1nj8b1.
(The format of our PDB-style files is described here.)

Timeline for d1nj8b1: