|  | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) | 
|  | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest | 
|  | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)  | 
|  | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) | 
|  | Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) | 
|  | Species Arhaeon (Methanocaldococcus janaschii) [89715] (1 PDB entry) | 
|  | Domain d1nj8b1: 1nj8 B:268-393 [85772] Other proteins in same PDB: d1nj8a2, d1nj8a3, d1nj8b2, d1nj8b3, d1nj8c2, d1nj8c3, d1nj8d2, d1nj8d3 | 
PDB Entry: 1nj8 (more details), 3.2 Å
SCOP Domain Sequences for d1nj8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj8b1 c.51.1.1 (B:268-393) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanocaldococcus janaschii)}
kglilppivapiqvvivplifkgkedivmekakeiyeklkgkfrvhiddrdirpgrkfnd
weikgvplrievgpkdienkkitlfrrdtmekfqvdetqlmevvektlnnimeniknraw
ekfenf
Timeline for d1nj8b1: