Lineage for d1nj8a1 (1nj8 A:268-393)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316209Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 316210Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 316246Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 316247Species Arhaeon (Methanocaldococcus janaschii) [89715] (1 PDB entry)
  8. 316248Domain d1nj8a1: 1nj8 A:268-393 [85769]
    Other proteins in same PDB: d1nj8a2, d1nj8a3, d1nj8b2, d1nj8b3, d1nj8c2, d1nj8c3, d1nj8d2, d1nj8d3

Details for d1nj8a1

PDB Entry: 1nj8 (more details), 3.2 Å

PDB Description: Crystal Structure of Prolyl-tRNA Synthetase from Methanocaldococcus janaschii

SCOP Domain Sequences for d1nj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj8a1 c.51.1.1 (A:268-393) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanocaldococcus janaschii)}
kglilppivapiqvvivplifkgkedivmekakeiyeklkgkfrvhiddrdirpgrkfnd
weikgvplrievgpkdienkkitlfrrdtmekfqvdetqlmevvektlnnimeniknraw
ekfenf

SCOP Domain Coordinates for d1nj8a1:

Click to download the PDB-style file with coordinates for d1nj8a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj8a1: