Lineage for d1ng7b1 (1ng7 B:2-60)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349064Fold a.178: Soluble domain of poliovirus core protein 3a [89042] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2349065Superfamily a.178.1: Soluble domain of poliovirus core protein 3a [89043] (1 family) (S)
    dimer of identical alpha-hairpin motifs
    automatically mapped to Pfam PF08727
  5. 2349066Family a.178.1.1: Soluble domain of poliovirus core protein 3a [89044] (1 protein)
  6. 2349067Protein Soluble domain of poliovirus core protein 3a [89045] (1 species)
  7. 2349068Species Poliovirus type 1, strain Mahoney [TaxId:12080] [89046] (1 PDB entry)
  8. 2349070Domain d1ng7b1: 1ng7 B:2-60 [85672]
    Other proteins in same PDB: d1ng7a2, d1ng7b2

Details for d1ng7b1

PDB Entry: 1ng7 (more details)

PDB Description: the solution structure of the soluble domain of poliovirus 3a protein
PDB Compounds: (B:) Genome polyprotein [Core protein P3A]

SCOPe Domain Sequences for d1ng7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng7b1 a.178.1.1 (B:2-60) Soluble domain of poliovirus core protein 3a {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gplqykdlkidiktspppecindllqavdsqevrdycekkgwivnitsqvqterninra

SCOPe Domain Coordinates for d1ng7b1:

Click to download the PDB-style file with coordinates for d1ng7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ng7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng7b2