Class a: All alpha proteins [46456] (289 folds) |
Fold a.178: Soluble domain of poliovirus core protein 3a [89042] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.178.1: Soluble domain of poliovirus core protein 3a [89043] (1 family) dimer of identical alpha-hairpin motifs automatically mapped to Pfam PF08727 |
Family a.178.1.1: Soluble domain of poliovirus core protein 3a [89044] (1 protein) |
Protein Soluble domain of poliovirus core protein 3a [89045] (1 species) |
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [89046] (1 PDB entry) |
Domain d1ng7b1: 1ng7 B:2-60 [85672] Other proteins in same PDB: d1ng7a2, d1ng7b2 |
PDB Entry: 1ng7 (more details)
SCOPe Domain Sequences for d1ng7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng7b1 a.178.1.1 (B:2-60) Soluble domain of poliovirus core protein 3a {Poliovirus type 1, strain Mahoney [TaxId: 12080]} gplqykdlkidiktspppecindllqavdsqevrdycekkgwivnitsqvqterninra
Timeline for d1ng7b1: