SCOPe 2.08: Domain d1ng7b1: 1ng7 B:2-60

Lineage for d1ng7b1 (1ng7 B:2-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.178: Soluble domain of poliovirus core protein 3a [89042] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.178.1: Soluble domain of poliovirus core protein 3a [89043] (1 family)
   dimer of identical alpha-hairpin motifs
   automatically mapped to Pfam PF08727

5. Family a.178.1.1: Soluble domain of poliovirus core protein 3a [89044] (1 protein)

6. Protein Soluble domain of poliovirus core protein 3a [89045] (1 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [89046] (1 PDB entry)

8. Domain d1ng7b1: 1ng7 B:2-60 [85672]
   Other proteins in same PDB: d1ng7a2, d1ng7b2

Details for d1ng7b1

PDB Entry: 1ng7

PDB Description: the solution structure of the soluble domain of poliovirus 3a protein

PDB Compounds: (B:) Genome polyprotein [Core protein P3A]

SCOPe Domain Sequences for d1ng7b1:

Sequence; same for both SEQRES and ATOM records:

>d1ng7b1 a.178.1.1 (B:2-60) Soluble domain of poliovirus core protein 3a {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gplqykdlkidiktspppecindllqavdsqevrdycekkgwivnitsqvqterninra

Timeline for d1ng7b1:

• d1ng7b1 first appeared in SCOP 1.65, called d1ng7b_
  
• d1ng7b1 appears in SCOPe 2.07