SCOPe 2.02: Domain d1ng2a1: 1ng2 A:157-214

Lineage for d1ng2a1 (1ng2 A:157-214)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)

8. Domain d1ng2a1: 1ng2 A:157-214 [85660]
   N-terminal domain forms a segment-swapped dimer; C-terminal domain includes the autoinhibition tail region, residues 284-333

Details for d1ng2a1

PDB Entry: 1ng2, 1.7 Å

PDB Description: structure of autoinhibited p47phox

PDB Compounds: (A:) Neutrophil cytosolic factor 1

SCOPe Domain Sequences for d1ng2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
ilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasflepld

Timeline for d1ng2a1:

• d1ng2a1 first appeared in SCOP 1.65
  
• d1ng2a1 appears in SCOPe 2.01
  
• d1ng2a1 appears in SCOPe 2.03
  
• d1ng2a1 appears in the current release, SCOPe 2.08