Lineage for d1ng2a1 (1ng2 A:157-214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946454Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 946455Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 946456Domain d1ng2a1: 1ng2 A:157-214 [85660]
    N-terminal domain forms a segment-swapped dimer; C-terminal domain includes the autoinhibition tail region, residues 284-333

Details for d1ng2a1

PDB Entry: 1ng2 (more details), 1.7 Å

PDB Description: structure of autoinhibited p47phox
PDB Compounds: (A:) Neutrophil cytosolic factor 1

SCOPe Domain Sequences for d1ng2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
ilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasflepld

SCOPe Domain Coordinates for d1ng2a1:

Click to download the PDB-style file with coordinates for d1ng2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng2a2