Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein) |
Protein Glycine N-methyltransferase [53349] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries) |
Domain d1nbid_: 1nbi D: [85523] complexed with sam |
PDB Entry: 1nbi (more details), 3 Å
SCOPe Domain Sequences for d1nbid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbid_ c.66.1.5 (D:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]} pdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrvldvacgtgvdsimlvee gfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltldkdvpagdgfdaviclg nsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyilstgcappgkniyyksd ltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrlsyyphclasftelvqea fggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
Timeline for d1nbid_: