Lineage for d1nbic_ (1nbi C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129396Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 2129397Protein Glycine N-methyltransferase [53349] (3 species)
  7. 2129414Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries)
  8. 2129445Domain d1nbic_: 1nbi C: [85522]
    complexed with sam

Details for d1nbic_

PDB Entry: 1nbi (more details), 3 Å

PDB Description: structure of r175k mutated glycine n-methyltransferase complexed with s-adenosylmethionine, r175k:sam.
PDB Compounds: (C:) glycine n-methyltransferase

SCOPe Domain Sequences for d1nbic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbic_ c.66.1.5 (C:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrvldvacgtgvdsimlvee
gfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltldkdvpagdgfdaviclg
nsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyilstgcappgkniyyksd
ltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrlsyyphclasftelvqea
fggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOPe Domain Coordinates for d1nbic_:

Click to download the PDB-style file with coordinates for d1nbic_.
(The format of our PDB-style files is described here.)

Timeline for d1nbic_: