Lineage for d1nayc_ (1nay C:)

  1. Root: SCOPe 2.06
  2. 2273425Class k: Designed proteins [58788] (44 folds)
  3. 2273467Fold k.3: Collagen-like peptides [58805] (1 superfamily)
  4. 2273468Superfamily k.3.1: Collagen-like peptides [58806] (1 family) (S)
  5. 2273469Family k.3.1.1: Collagen-like peptides [58807] (1 protein)
  6. 2273470Protein Collagen-like peptides [58808] (8 species)
  7. 2273520Species Synthetic, [(pro-pro-gly)10]3 triple helix model [70052] (2 PDB entries)
  8. 2273529Domain d1nayc_: 1nay C: [85504]
    foldon is a trimerisation domain of T4 fibritin

Details for d1nayc_

PDB Entry: 1nay (more details), 2.6 Å

PDB Description: gpp-foldon:x-ray structure
PDB Compounds: (C:) collagen-like peptide

SCOPe Domain Sequences for d1nayc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nayc_ k.3.1.1 (C:) Collagen-like peptides {Synthetic, [(pro-pro-gly)10]3 triple helix model}
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

SCOPe Domain Coordinates for d1nayc_:

Click to download the PDB-style file with coordinates for d1nayc_.
(The format of our PDB-style files is described here.)

Timeline for d1nayc_: