PDB entry 1nay

View 1nay on RCSB PDB site
Description: GPP-Foldon:X-ray structure
Class: structural protein
Keywords: collagen assembly, STRUCTURAL PROTEIN
Deposited on 2002-11-29, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: collagen-like peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1NAY
  Domains in SCOPe 2.06: d1naya_
• Chain 'B':
  Compound: collagen-like peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1NAY
  Domains in SCOPe 2.06: d1nayb_
• Chain 'C':
  Compound: collagen-like peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1NAY (0-55)
  Domains in SCOPe 2.06: d1nayc_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nayA (A:)
  gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1nayB (B:)
  gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1nayB (B:)
  ppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nayC (C:)
  gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl