Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries) |
Domain d1na8b_: 1na8 B: [85485] Other proteins in same PDB: d1na8a2 |
PDB Entry: 1na8 (more details), 2.3 Å
SCOPe Domain Sequences for d1na8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1na8b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]} lslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqp irnivfqsavpkvmkvklqppsgmelpafnpivhpsaitqvlllanpqkekvrlrykltf tmgdqtynemgdvdqfpppetwgsl
Timeline for d1na8b_: