SCOPe 2.06: Domain d1na8b_: 1na8 B:

Lineage for d1na8b_ (1na8 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)

8. Domain d1na8b_: 1na8 B: [85485]
   Other proteins in same PDB: d1na8a2

Details for d1na8b_

PDB Entry: 1na8, 2.3 Å

PDB Description: crystal structure of adp-ribosylation factor binding protein gga1

PDB Compounds: (B:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1na8b_:

Sequence; same for both SEQRES and ATOM records:

>d1na8b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
lslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqp
irnivfqsavpkvmkvklqppsgmelpafnpivhpsaitqvlllanpqkekvrlrykltf
tmgdqtynemgdvdqfpppetwgsl

Timeline for d1na8b_:

• d1na8b_ first appeared in SCOP 1.65
  
• d1na8b_ appears in SCOPe 2.05
  
• d1na8b_ appears in SCOPe 2.07
  
• d1na8b_ appears in the current release, SCOPe 2.08