Lineage for d1na8b_ (1na8 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291298Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) (S)
    contains an additional N-terminal strand
  5. 291314Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
    consist of a single subdomain
  6. 291315Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)
  7. 291316Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries)
  8. 291318Domain d1na8b_: 1na8 B: [85485]

Details for d1na8b_

PDB Entry: 1na8 (more details), 2.3 Å

PDB Description: crystal structure of adp-ribosylation factor binding protein gga1

SCOP Domain Sequences for d1na8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na8b_ b.1.10.2 (B:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens)}
lslasitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqp
irnivfqsavpkvmkvklqppsgmelpafnpivhpsaitqvlllanpqkekvrlrykltf
tmgdqtynemgdvdqfpppetwgsl

SCOP Domain Coordinates for d1na8b_:

Click to download the PDB-style file with coordinates for d1na8b_.
(The format of our PDB-style files is described here.)

Timeline for d1na8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1na8a_