Lineage for d1n8bd_ (1n8b D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433261Fold b.127: Baseplate structural protein gp8 [89432] (1 superfamily)
    multisheet protein with a mixture of beta-sandwich and beta-barrel features
  4. 2433262Superfamily b.127.1: Baseplate structural protein gp8 [89433] (1 family) (S)
    automatically mapped to Pfam PF09215
  5. 2433263Family b.127.1.1: Baseplate structural protein gp8 [89434] (1 protein)
  6. 2433264Protein Baseplate structural protein gp8 [89435] (1 species)
  7. 2433265Species Bacteriophage T4 [TaxId:10665] [89436] (3 PDB entries)
  8. 2433277Domain d1n8bd_: 1n8b D: [85396]
    complexed with br

Details for d1n8bd_

PDB Entry: 1n8b (more details), 2.9 Å

PDB Description: Bacteriophage T4 baseplate structural protein gp8
PDB Compounds: (D:) baseplate structural protein gp8

SCOPe Domain Sequences for d1n8bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8bd_ b.127.1.1 (D:) Baseplate structural protein gp8 {Bacteriophage T4 [TaxId: 10665]}
iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl
gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga
gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy
vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant
irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs
gemiymenrppiimamdqteeinilftf

SCOPe Domain Coordinates for d1n8bd_:

Click to download the PDB-style file with coordinates for d1n8bd_.
(The format of our PDB-style files is described here.)

Timeline for d1n8bd_: