Class b: All beta proteins [48724] (178 folds) |
Fold b.127: Baseplate structural protein gp8 [89432] (1 superfamily) multisheet protein with a mixture of beta-sandwich and beta-barrel features |
Superfamily b.127.1: Baseplate structural protein gp8 [89433] (1 family) automatically mapped to Pfam PF09215 |
Family b.127.1.1: Baseplate structural protein gp8 [89434] (1 protein) |
Protein Baseplate structural protein gp8 [89435] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [89436] (3 PDB entries) |
Domain d1n8ba_: 1n8b A: [85393] complexed with br |
PDB Entry: 1n8b (more details), 2.9 Å
SCOPe Domain Sequences for d1n8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8ba_ b.127.1.1 (A:) Baseplate structural protein gp8 {Bacteriophage T4 [TaxId: 10665]} iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs gemiymenrppiimamdqteeinilftf
Timeline for d1n8ba_: