Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (3 species) different pattern for Cys-pairing compared with ns-LTP1 |
Species English wheat (Triticum turgidum) [TaxId:4571] [89073] (1 PDB entry) |
Domain d1n89a_: 1n89 A: [85392] complexed with pgm |
PDB Entry: 1n89 (more details)
SCOPe Domain Sequences for d1n89a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n89a_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {English wheat (Triticum turgidum) [TaxId: 4571]} acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc glavphc
Timeline for d1n89a_: