Lineage for d1n89a_ (1n89 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714862Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2714863Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (3 species)
    different pattern for Cys-pairing compared with ns-LTP1
  7. 2714864Species English wheat (Triticum turgidum) [TaxId:4571] [89073] (1 PDB entry)
  8. 2714865Domain d1n89a_: 1n89 A: [85392]
    complexed with pgm

Details for d1n89a_

PDB Entry: 1n89 (more details)

PDB Description: solution structure of a liganded type 2 wheat non-specific lipid transfer protein
PDB Compounds: (A:) lipid transfer protein

SCOPe Domain Sequences for d1n89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n89a_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {English wheat (Triticum turgidum) [TaxId: 4571]}
acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc
glavphc

SCOPe Domain Coordinates for d1n89a_:

Click to download the PDB-style file with coordinates for d1n89a_.
(The format of our PDB-style files is described here.)

Timeline for d1n89a_: