Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
Species Archaeon Aeropyrum pernix [TaxId:56636] [89493] (1 PDB entry) |
Domain d1n7ka_: 1n7k A: [85374] |
PDB Entry: 1n7k (more details), 2 Å
SCOP Domain Sequences for d1n7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} psardilqqgldrlgspedlasridstllsprateedvrnlvreasdygfrcavltpvyt vkisglaeklgvklcsvigfplgqaplevklveaqtvleagateldvvphlslgpeavyr evsgivklaksygavvkvileaplwddktlsllvdssrragadivktstgvytkggdpvt vfrlaslakplgmgvkasggirsgidavlavgagadiigtssavkvlesfkslv
Timeline for d1n7ka_: