Lineage for d1n7ka_ (1n7k A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684034Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 684038Species Archaeon Aeropyrum pernix [TaxId:56636] [89493] (1 PDB entry)
  8. 684039Domain d1n7ka_: 1n7k A: [85374]

Details for d1n7ka_

PDB Entry: 1n7k (more details), 2 Å

PDB Description: unique tetrameric structure of deoxyribose phosphate aldolase from aeropyrum pernix
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOP Domain Sequences for d1n7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]}
psardilqqgldrlgspedlasridstllsprateedvrnlvreasdygfrcavltpvyt
vkisglaeklgvklcsvigfplgqaplevklveaqtvleagateldvvphlslgpeavyr
evsgivklaksygavvkvileaplwddktlsllvdssrragadivktstgvytkggdpvt
vfrlaslakplgmgvkasggirsgidavlavgagadiigtssavkvlesfkslv

SCOP Domain Coordinates for d1n7ka_:

Click to download the PDB-style file with coordinates for d1n7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1n7ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n7kb_