Lineage for d1n6ba1 (1n6b A:27-487)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005374Protein Mammalian cytochrome p450 2c5 [48280] (1 species)
  7. 2005375Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48281] (3 PDB entries)
  8. 2005377Domain d1n6ba1: 1n6b A:27-487 [85359]
    Other proteins in same PDB: d1n6ba2
    complexed with dmz, hem, so4

Details for d1n6ba1

PDB Entry: 1n6b (more details), 2.3 Å

PDB Description: Microsomal Cytochrome P450 2C5/3LVdH Complex with a dimethyl derivative of sulfaphenazole
PDB Compounds: (A:) cytochrome p450 2c5

SCOPe Domain Sequences for d1n6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ba1 a.104.1.1 (A:27-487) Mammalian cytochrome p450 2c5 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlhgyeavkea
lvdlgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgkrsiedriq
eearclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklmeslhenve
llgtpwlqvynnfpalldyfpgihktllknadyiknfimekvkehqklldvnnprdfidc
flikmeqennleftleslviavsdlfgagtettsttlryslllllkhpevaarvqeeier
vigrhrspcmqdrsrmpytdaviheiqrfidllptnlphavtrdvrfrnyfipkgtdiit
sltsvlhdekafpnpkvfdpghfldesgnfkksdyfmpfsagkrmcvgeglarmelflfl
tsilqnfklqslvepkdlditavvngfvsvppsyqlcfipi

SCOPe Domain Coordinates for d1n6ba1:

Click to download the PDB-style file with coordinates for d1n6ba1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n6ba2