PDB entry 1n6b

View 1n6b on RCSB PDB site
Description: Microsomal Cytochrome P450 2C5/3LVdH Complex with a dimethyl derivative of sulfaphenazole
Class: oxidoreductase
Keywords: membrane protein, progesterone 21-hydroxylase, benzo(a), pyrene hydroxylase, estradiol 2-hydroxylase, p450, cyp2c5, dimethylsulfaphenazole complex, oxidoreductase
Deposited on 2002-11-09, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.257
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 2c5
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CYP2C5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00179 (8-468)
      • engineered (183)
      • engineered (187-188)
      • engineered (190-191)
      • expression tag (469)
    Domains in SCOPe 2.07: d1n6ba1, d1n6ba2
  • Heterogens: SO4, HEM, DMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6bA (A:)
    makktsskgklppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlh
    gyeavkealvdlgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgk
    rsiedriqeearclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklm
    eslhenvellgtpwlqvynnfpalldyfpgihktllknadyiknfimekvkehqklldvn
    nprdfidcflikmeqennleftleslviavsdlfgagtettsttlryslllllkhpevaa
    rvqeeiervigrhrspcmqdrsrmpytdaviheiqrfidllptnlphavtrdvrfrnyfi
    pkgtdiitsltsvlhdekafpnpkvfdpghfldesgnfkksdyfmpfsagkrmcvgegla
    rmelflfltsilqnfklqslvepkdlditavvngfvsvppsyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6bA (A:)
    gklppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlhgyeavkea
    lvdlgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgkrsiedriq
    eearclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklmeslhenve
    llgtpwlqvynnfpalldyfpgihktllknadyiknfimekvkehqklldvnnprdfidc
    flikmeqennleftleslviavsdlfgagtettsttlryslllllkhpevaarvqeeier
    vigrhrspcmqdrsrmpytdaviheiqrfidllptnlphavtrdvrfrnyfipkgtdiit
    sltsvlhdekafpnpkvfdpghfldesgnfkksdyfmpfsagkrmcvgeglarmelflfl
    tsilqnfklqslvepkdlditavvngfvsvppsyqlcfipih