Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.3: Cathelicidin motif [82592] (2 proteins) cathelin-like domain |
Protein Cathelicidin motif of protegrin-3 [82593] (1 species) antimicrobial protein |
Species Pig (Sus scrofa) [TaxId:9823] [82594] (5 PDB entries) |
Domain d1n5pa_: 1n5p A: [85338] |
PDB Entry: 1n5p (more details)
SCOPe Domain Sequences for d1n5pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5pa_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa) [TaxId: 9823]} gshmqalsyreavlravdrlneqsseanlyrlleldqppkadedpgtpkpvsftvketvc prptrqppelcdfkengrvkqcvgtvtldqikdplditcnevqgv
Timeline for d1n5pa_: