SCOP 1.65: Domain d1n5pa_: 1n5p A:

Lineage for d1n5pa_ (1n5p A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.17: Cystatin-like [54402] (6 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (3 families)
   has a additional strand at the N-terminus

5. Family d.17.1.3: Cathelicidin motif [82592] (1 protein)
   cathelin-like domain

6. Protein Cathelicidin motif of protegrin-3 [82593] (1 species)
   antimicrobial protein

7. Species Pig (Sus scrofa) [TaxId:9823] [82594] (4 PDB entries)

8. Domain d1n5pa_: 1n5p A: [85338]

Details for d1n5pa_

PDB Entry: 1n5p

PDB Description: solution structure of the cathelin-like domain of protegrins (all amide bonds involving proline residues are in trans conformation)

SCOP Domain Sequences for d1n5pa_:

Sequence; same for both SEQRES and ATOM records:

>d1n5pa_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa)}
gshmqalsyreavlravdrlneqsseanlyrlleldqppkadedpgtpkpvsftvketvc
prptrqppelcdfkengrvkqcvgtvtldqikdplditcnevqgv

Timeline for d1n5pa_:

• d1n5pa_ is new in SCOP 1.65
  
• d1n5pa_ appears in SCOP 1.67
  
• d1n5pa_ appears in the current release, SCOPe 2.08, called d1n5pa1