SCOPe 2.01: Domain d1n4la_: 1n4l A:

Lineage for d1n4la_ (1n4l A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d1n4la_: 1n4l A: [85323]
   fragment of "palm" and "fingers" domains
   protein/DNA complex

Details for d1n4la_

PDB Entry: 1n4l, 2 Å

PDB Description: a dna analogue of the polypurine tract of hiv-1

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1n4la_:

Sequence; same for both SEQRES and ATOM records:

>d1n4la_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

Timeline for d1n4la_:

• d1n4la_ first appeared in SCOP 1.65
  
• d1n4la_ appears in SCOP 1.75
  
• d1n4la_ appears in SCOPe 2.02
  
• d1n4la_ appears in the current release, SCOPe 2.08