PDB entry 1n4l

View 1n4l on RCSB PDB site
Description: A DNA analogue of the polypurine tract of HIV-1
Class: transferase/DNA
Keywords: MMLV RT; Polypurine Tract; HIV-1; Asymmetric DNA; protein-DNA complex, TRANSFERASE/DNA COMPLEX
Deposited on 2002-10-31, released 2003-06-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1n4la_
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*tp*tp*tp*ap*ap*ap*ap*gp*ap*ap*ap*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*tp*tp*tp*cp*tp*tp*tp*tp*ap*ap*ap*ap*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n4lA (A:)
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.