Lineage for d1my0c_ (1my0 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185560Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1185569Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (104 PDB entries)
  8. 1185717Domain d1my0c_: 1my0 C: [85219]
    complexed with zn

Details for d1my0c_

PDB Entry: 1my0 (more details), 1.9 Å

PDB Description: crystal titration experiments (ampa co-crystals soaked in 100 nm brw)
PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d1my0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1my0c_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d1my0c_:

Click to download the PDB-style file with coordinates for d1my0c_.
(The format of our PDB-style files is described here.)

Timeline for d1my0c_: