Lineage for d1mxga2 (1mxg A:1-361)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1568717Protein Bacterial alpha-amylase [51447] (10 species)
  7. 1568759Species Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries)
  8. 1568760Domain d1mxga2: 1mxg A:1-361 [85194]
    Other proteins in same PDB: d1mxga1
    complexed with acr, ca, eoh, ete, mg, trs, zn

Details for d1mxga2

PDB Entry: 1mxg (more details), 1.6 Å

PDB Description: crystal structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1mxga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Pyrococcus woesei [TaxId: 2262]}
akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm
gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn
pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn
esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga
kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay
afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr
r

SCOPe Domain Coordinates for d1mxga2:

Click to download the PDB-style file with coordinates for d1mxga2.
(The format of our PDB-style files is described here.)

Timeline for d1mxga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mxga1