SCOP 1.65: Domain d1mxga2: 1mxg A:1-361

Lineage for d1mxga2 (1mxg A:1-361)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial alpha-amylase [51447] (7 species)

7. Species Archaeon Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries)

8. Domain d1mxga2: 1mxg A:1-361 [85194]
   Other proteins in same PDB: d1mxga1
   complexed with acr, ca, eoh, ete, mg, trs, zn

Details for d1mxga2

PDB Entry: 1mxg, 1.6 Å

PDB Description: crystal structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose

SCOP Domain Sequences for d1mxga2:

Sequence; same for both SEQRES and ATOM records:

>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei}
akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm
gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn
pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn
esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga
kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay
afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr
r

Timeline for d1mxga2:

• d1mxga2 is new in SCOP 1.65
  
• d1mxga2 appears in SCOP 1.67
  
• d1mxga2 appears in the current release, SCOPe 2.08