Lineage for d1muqb_ (1muq B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940632Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 1940633Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 1940640Domain d1muqb_: 1muq B: [85112]
    complexed with ca, gal, na, tdg

Details for d1muqb_

PDB Entry: 1muq (more details), 2.3 Å

PDB Description: x-ray crystal structure of rattlesnake venom complexed with thiodigalactoside
PDB Compounds: (B:) Galactose-specific lectin

SCOPe Domain Sequences for d1muqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muqb_ d.169.1.1 (B:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk
gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq
vceskdaflcqckf

SCOPe Domain Coordinates for d1muqb_:

Click to download the PDB-style file with coordinates for d1muqb_.
(The format of our PDB-style files is described here.)

Timeline for d1muqb_: