Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Galactose-specific C-type lectin [90061] (1 species) |
Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries) |
Domain d1muqb_: 1muq B: [85112] complexed with ca, gal, na, tdg |
PDB Entry: 1muq (more details), 2.3 Å
SCOPe Domain Sequences for d1muqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muqb_ d.169.1.1 (B:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq vceskdaflcqckf
Timeline for d1muqb_:
View in 3D Domains from other chains: (mouse over for more information) d1muqa_, d1muqc_, d1muqd_, d1muqe_ |