SCOPe 2.06: Domain d1mt1.3: 1mt1 E:,F:

Lineage for d1mt1.3 (1mt1 E:,F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
   duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich

4. Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)
   two chains result from self-processing single-chain precursor; form heterohexamer

5. Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)

6. Protein Arginine decarboxylase [90047] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)

8. Domain d1mt1.3: 1mt1 E:,F: [85099]
   complexed with ag2

Details for d1mt1.3

PDB Entry: 1mt1, 2.2 Å

PDB Description: the crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii

PDB Compounds: (E:) pyruvoyl-dependent arginine decarboxylase beta chain, (F:) pyruvoyl-dependent arginine decarboxylase alpha chain

SCOPe Domain Sequences for d1mt1.3:

Sequence; same for both SEQRES and ATOM records:

>g1mt1.3 d.155.1.2 (E:,F:) Arginine decarboxylase {Methanococcus jannaschii [TaxId: 2190]}
aeinplhayfklpntvslvagssegetplnafdgallnagignvnlirisXximppeaei
vplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaek
tvremakigfemrgweldriesiavehtveklgcafaaaalwyk

Timeline for d1mt1.3:

• d1mt1.3 first appeared in SCOP 1.65
  
• d1mt1.3 appears in SCOPe 2.05
  
• d1mt1.3 appears in SCOPe 2.07
  
• d1mt1.3 appears in the current release, SCOPe 2.08